авторефераты диссертаций www.z-pdf.ru
БЕСПЛАТНАЯ ЭЛЕКТРОННАЯ БИБЛИОТЕКА
 

На правах рукописи

КАТИНА НАТАЛЬЯ СЕРГЕЕВНА

АМИЛОИДНАЯ АГРЕГАЦИЯ АПОМИОГЛОБИНА И ЕГО

МУТАНТНЫХ ФОРМ

03.01.03-молекулярная биология

АВТОРЕФЕРАТ

диссертации на соискание ученой степени

кандидата биологических наук

ПУЩИНО – 2016

ОБЩАЯ ХАРАКТЕРИСТИКА РАБОТЫ

Актуальность темы исследования. Для выполнения своей функции

белок должен приобрести уникальную пространственную структуру в процессе

сворачивания. Однако в клетке возможны условия, при которых белок не

способен свернуться в нативную конформацию. Это приводит к утрате им

функциональной

активности

и

образованию

белковых

агрегатов,

разновидностью которых являются амилоиды. Амилоиды представляют собой

высокоупорядоченные

фибриллярные

агрегаты,

содержащие

кросс-β-

структуру. Формирование амилоидов в клетке приводит к развитию серьёзных

заболеваний человека, таких как болезнь Альцгеймера, Паркинсона, диабет

второго типа и других. К настоящему времени не разработано эффективных

способов лечения амилоидных заболеваний. Поэтому изучение механизма

формирования амилоидных фибрилл является одним из важных направлений

современных исследований молекулярной биологии и медицины.

Степень разработанности научной проблемы. В ранних работах,

посвященных изучению амилоидной агрегации, было показано, что для

формирования амилоидов необходимо дестабилизировать нативное состояние

белка. В результате большинство последующих исследований механизма

амилоидообразования было проведено в денатурирующих условиях, при

которых происходит разворачивание полипептидной цепи. Однако механизм

агрегации структурированных белков в условиях клетки может в значительной

степени отличаться от агрегации развернутой полипептидной цепи. Тем не

менее, к настоящему времени агрегация белков из структурированного

состояния остается недостаточно изученной, что не позволяет выявить общие

закономерности амилоидообразования глобулярными белками в клетке.

Цель и задачи работы. Целью данной работы было исследование

механизма амилоидной агрегации глобулярного белка в условиях, близких к

физиологическим.

В качестве модели для данной работы был выбран апомиоглобин

кашалота, так как процесс сворачивания этого белка к настоящему времени

подробно исследован.

В работе были поставлены следующие задачи:

1. Охарактеризовать агрегаты, образуемые апомиоглобином дикого типа и

его мутантными формами.

2. Исследовать

влияние

аминокислотных

замен

на

способность

апомиоглобина формировать амилоидные структуры.

3

3. Определить участок апомиоглобина, образующий межмолекулярные

взаимодействия в структуре амилоидных агрегатов.

4. Исследовать влияние аминокислотных замен на скорость амилоидной

агрегации апомиоглобина.

Методы исследования. Для получения и выделения апомиоглобина

дикого типа и его мутантных форм использовали следующие биохимические

методы: трансформация бактериальных клеток, экспрессия белков в клетках

Escherichia coli BL21(DЕ3), электрофорез в ПААГ и высокоэффективная

жидкостная хроматография. Исследование белковых агрегатов проводили с

применением методов нативного электрофореза,

кругового дихроизма,

инфракрасной спектроскопии, поглощения конго красного, флуоресценции

тиофлавина

Т,

аналитического

ультрацентрифугирования,

электронной

микроскопии и дифракции рентгеновских лучей. Для определения участка

белка, образующего межмолекулярные взаимодействия в структуре амилоидов,

использовали метод ограниченного протеолиза агрегатов и последующий

анализ полученных пептидов с применением масс-спектрометрии. Кинетику

амилоидообразования исследовали методами флуоресценции тиофлавина Т,

инфракрасной спектроскопии и электронной микроскопии.

Научная

новизна

работы.

В

диссертации

впервые

проведено

исследование влияния аминокислотных замен на амилоидообразование α-

спирального белка в неденатурирующих условиях.

1. В работе показано, что апомиоглобин кашалота и его мутантные

формы образуют амилоиды при температуре 40°С и рН 5,5.

2.

Особенность

данной

работы

заключается

в

исследовании

амилоидообразования, как частного случая агрегации белка. Поэтому в работе

было отдельно изучено влияние аминокислотных замен в апомиоглобине на его

способность к агрегации и на способность к формированию амилоидов. Такой

подход позволил обнаружить наличие двух различных путей агрегации

апомиоглобина в одних и тех же условиях растворителя.

3. С помощью методов ограниченного протеолиза и масс-спектрометрии

определены

участки

апомиоглобина,

образующие

межмолекулярные

взаимодействия в структуре амилоидов.

4. Исследованы стадии амилоидообразования апомиоглобина, а также

влияние

аминокислотных

замен

на

кинетику агрегации.

Непрерывная

регистрация кинетических кривых агрегации позволила достоверно рассчитать

скорости двух стадий амилоидообразования апомиоглобина и определить

факторы, влияющие на первую и вторую видимые стадии агрегации.

4

Теоретическая и практическая значимость работы. Результаты,

полученные

в данной работе,

позволили на примере апомиоглобина

обнаружить особенности амилоидной агрегации глобулярного белка в

неденатурирующих условиях и определить факторы, влияющие как на

способность белка формировать амилоиды, так и на скорость этого процесса.

Получение такой информации представляет собой необходимый этап на пути

выяснения причин развития амилоидных заболеваний и разработки подходов к

их лечению.

Апробация

результатов

исследования.

Основные

положения

диссертации

были

представлены

на

международных

и

всероссийских

конференциях. Результаты диссертационной работы отражены в 26 печатных

работах, в том числе 7 статьях в рецензируемых отечественных и

международных научных журналах, среди которых журналы «Молекулярная

биология»,

«Биохимия»,

«Protein

Science»,

«Biophysical

Journal»

и

«Macromolecular Symposia».

Структура диссертации. Диссертация состоит из введения, обзора

литературы, материалов и методов, результатов и их обсуждений, заключения,

выводов и списка цитируемой литературы. Работу иллюстрируют 32 рисунка и

4 таблицы. Объем диссертации составляет 134 страницы.

РЕЗУЛЬТАТЫ И ОБСУЖДЕНИЯ

В

качестве

условий

для

исследования

амилоидной

агрегации

апомиоглобина была выбрана температура 40°С и рН 5,5. В данных условиях

молекулы апомиоглобина сохраняют вторичную и третичную структуру, а

также способны выполнять свою функцию - связывать гем.

1. Характеристика агрегатов, формируемых апомиоглобином и его

мутантными формами при температуре 40°С и рН 5,5

В работе исследованы морфология и вторичная структура агрегатов,

образуемых белком дикого типа и его 11-тью мутантными формами, после 24

часов инкубации при температуре 40°С. К этому времени все регистрируемые

параметры выходят на плато, и процесс агрегации практически завершен. В

данной главе в качестве примера приведены результаты, полученные для белка

с заменой V10F, так как эта мутантная форма характеризуется высокой

амилоидогенностью.

Результаты электронной микроскопии свидетельствует о том, что в

5

исследованных условиях апомиоглобин образует извитые фибриллы длиной до

100 нм, в растворе также присутствует некоторая доля глобулярных агрегатов

(Рис. 1а).

Одним из методов, используемых для регистрации амилоидных структур,

является флуоресценция специфического красителя тиофлавина Т. Возрастание

интенсивности

флуоресценции

тиофлавина

после

инкубации

раствора

апомиоглобина при 40°С указывает на то, что образованные агрегаты содержат

кросс-β-структуру (Рис. 1б).

Рис. 1. а) Электронная микрофотография агрегатов апомиоглобина V10F; б) спектры

флуоресценции тиофлавина Т: сплошной линией показан спектр раствора до инкубации,

пунктиром – спектр раствора после инкубации.

Для исследования вторичной структуры агрегатов был использован метод

инфракрасной (ИК) спектроскопии. Одно из преимуществ данного метода для

изучения амилоидных агрегатов заключается в том, что по ИК спектрам можно

не только регистрировать β-структуру, но и отличить β-структуру глобулярных

белков, которая поглощает в области 1630-1643 см-1, от кросс-β-структуры

амилоидов,

пик

поглощения

которой

соответствует

1611-1630

см-1

[Zandomeneghi, 2004]. Поэтому появление на спектрах раствора апомиоглобина

после

инкубации

дополнительного

пика

поглощения

на

1620

см-1

свидетельствует о том, что сформированные агрегаты содержат кросс-β-

структуру (Рис. 2а).

Для оценки процентного содержания основных типов вторичной

структуры в агрегатах апомиоглобина было проведено разложение полученного

ИК спектра по Гауссовым компонентам с использованием программы OMNIC.

Анализ площадей полученных пиков свидетельствует о том, что содержание α-

спиралей в агрегатах составляет примерно 39%, β-структуры – 41%,

развернутых элементов – 4%, неупорядоченных структурных элементов или

поворотов – 16% (Рис. 2б).

6

Рис.

2.

Данные

инфракрасной

спектроскопии:

а)

инфракрасные

спектры

апомиоглобина V10F до инкубации (сплошная линия) и после инкубации (пунктирная

линия); б) разложение спектра агрегатов по Гауссовым компонентам (1-5, 11 – β-структура, 6

– клубок, 7 – α – спирали, 8-10 – неупорядоченные элементы или повороты [Adochitei, 2011]).

Для амилоидной кросс-β-структуры характерна высокая периодичность:

расстояние между β-тяжами вдоль оси фибриллы соответствует 4,7Å, а

расстояние между β-листами в направлении, перпендикулярном оси амилоидов,

равно 10-11 Å. Поэтому наличие на рентгенограмме фибрилл апомиоглобина

V10F рефлексов 4,71 Å и 10,10 Å является доказательством присутствия в

агрегатах кросс-β-структуры (Рис. 3).

4,71Å

10,10Å

Рис.3. Дифракционная картина фибрилл мутантной формы апомиоглобина V10F.

Таким образом, полученные результаты позволяют сделать вывод о том,

что при температуре 40°С и рН 5,5 апомиоглобин и его мутантные формы

образуют амилоиды.

7

2. Исследование стабильности апомиоглобина дикого типа и его

мутантных форм

Несмотря на то, что процесс сворачивания апомиоглобина кашалота

довольно подробно изучен, механизм амилоидной агрегации данного белка

остается недостаточно исследованным. В частности, нет однозначного ответа

на вопрос о том, какие условия необходимы для амилоидообразования

апомиоглобина. Так, в группе Sirangelo было обнаружено, что

мутантная

форма апомиоглобина кашалота W7FW14F способна к амилоидной агрегации в

условиях, близких к нативным. При этом авторами было высказано

предположение, что причиной высокой амилоидогенности этого белка является

введение аминокислотных замен в амилоидогенный участок апомиоглобина (А-

спираль) [Iannuzzi, 2007]. Возникает вопрос о том, действительно ли

локализация аминокислотной замены оказывает значительное влияние на

амилоидогенность мутантных форм апомиоглобина? Чтобы однозначно

ответить

на

него,

необходимо

исследовать

влияние

нескольких

аминокислотных замен, расположенных в различных участках белка, на его

способность к амилоидообразованию.

С этой целью нами были получены 11 мутантных форм апомиоглобина,

содержащие замены в пяти позициях, причем замены в одной и той же позиции

проводили на аминокислотные остатки, различающиеся по гидрофобности:

V10A, V10F, W14A и W14F (А-спираль); E109Y, E109F, L115A, L115F (G-

спираль); M131A, M131W (H-спираль); V10AM131A (А- и Н-спираль).

Замененные аминокислотные остатки показаны на структуре белка на рисунке

4.

Рис. 4.

Пространственная структура миоглобина кашалота. Показано положение

замененных аминокислотных остатков.

8

Полученный ряд мутантных форм удобен тем, что позволяет получить

информацию о влиянии не только позиции аминокислотных замен, но также

стабильности белка и гидрофобности остатков на амилоидную агрегацию

апомиоглобина.

В первую очередь мы исследовали стабильность апомиоглобина дикого

типа и его мутантных форм в условиях агрегации (рН 5,5 и 40°С). Провести

сравнение стабильности белков в данных условиях можно, используя переходы

равновесного разворачивания понижением рН при температуре 40°С. Однако

такие переходы сложны для интерпретации, так как мутантные формы

апомиоглобина агрегируют при повышении температуры при рН раствора выше

5,5. Поэтому для сравнения стабильности белков при рН 5,5 и температуре 40°С

мы провели измерение и совместный обсчет переходов равновесного

разворачивания понижением рН при температуре 11°С, где агрегация белков

незначительна, и кривых температурного плавления при рН 5,5.

Рис. 5. Исследование стабильности апомиоглобина дикого типа и его мутантных

форм: а, б) переходы равновесного разворачивания понижением рН при температуре 11°С и

в, г) температурное плавление при рН 5,5, регистрируемые методом КД в дальней УФ

области. Базовые линии N, I и U соответствуют накоплению нативного, промежуточного и

развернутого состояний, соответственно.

9

Равновесное разворачивание белков понижением рН, а также их

температурное плавление регистрировали методом кругового дихроизма (КД) в

дальней ультрафиолетовой (УФ) области. Переходы строили по изменению

молярной эллиптичности на длине волны 222 нм, значение которой несет

информацию о содержании в белке α-спиральной структуры (Рис. 5).

Дестабилизация нативной структуры мутантных белков по сравнению с

апомиоглобином дикого типа проявляется в виде сдвига перехода N→I в

область более высоких значений рН и увеличения доли промежуточного

состояния в конкретных условиях. Поэтому в качестве меры стабильности

белковой структуры удобно использовать значения доли нативного f(N) и

промежуточного f(I) состояний при температуре 40°С и рН 5,5. Значения

данных

величин

были

получены

из

совместного

обсчета

переходов

равновесного разворачивания и кривых температурного плавления по модели

двухстадийного разворачивания [Pace, 1986].

3. Исследование способности мутантных форм апомиоглобина

формировать агрегаты

Так как формирование амилоидов в клетках связано с развитием

заболеваний, то большая часть исследований процесса агрегации, описанных в

литературе, посвящена изучению именно амилоидообразования. Однако

амилоиды - это лишь один из типов белковых агрегатов. Для того чтобы понять

фундаментальные закономерности агрегации белка, важно ответить на вопросы

о том, какие факторы приводят к образованию белковых агрегатов, и при каких

условиях образующиеся агрегаты являются амилоидными. Поэтому в нашей

работе мы отдельно исследуем влияние аминокислотных замен на способность

апомиоглобина к агрегации и на способность к формированию амилоидов.

Для

исследования

способности

мутантных

форм

апомиоглобина

формировать агрегаты мы использовали метод нативного электрофореза:

растворы всех исследованных белков после окончания процесса агрегации

(24ч) наносили в слоты и проводили электрофорез в отсутствие денатуранта

(Рис. 6).

Так как агрегаты апомиоглобина гетерогенны и частично не входят в

разделяющий гель, то интенсивность окраски их полос нельзя рассчитать

достоверно. Однако можно с высокой точностью рассчитать интенсивность

окраски полосы мономера, расположенной в нижней части геля. Значение этой

величины несет информацию о количестве мономерного белка, оставшегося в

растворе, и обратно пропорционально содержанию агрегатов.

10

Рис. 6. Электрофореграмма растворов агрегатов, образуемых апомиоглобином дикого

типа и его мутантными формами. В качестве репера в последний слот нанесен мономерный

белок дикого типа.

На рисунке 7 представлены зависимости интенсивности окраски полосы

мономера от позиции аминокислотной замены, а также от доли нативного и

промежуточного состояний в условиях агрегации.

Рис. 7. Зависимость интенсивности окраски полосы мономерного апомиоглобина на

электрофореграмме белковых растворов после 24 ч инкубации (нормировано относительно

значения для белка дикого типа): а) от позиции аминокислотной замены; б) от доли

промежуточного и нативного состояний при температуре 40°С и рН 5,5.

Из рисунка видно, что способность апомиоглобина формировать агрегаты

не зависит от позиции аминокислотной замены, тогда как основным фактором,

влияющим на агрегационную способность белка, является стабильность

нативного состояния относительно промежуточного: накопление в растворе

молекул в промежуточном состоянии приводит к агрегации апомиоглобина.

Выход графика на плато свидетельствует о том, что мутантные формы,

популяция промежуточного состояния которых в исследованных условиях

выше 25%, за время инкубации практически полностью переходят в агрегаты.

11

4. Исследование способности мутантных форм апомиоглобина

формировать амилоиды

Следующей

задачей

работы

было

определить,

каким

образом

аминокислотные замены влияют на способность апомиоглобина формировать

амилоидные агрегаты. Специфической характеристикой амилоидов является

наличие

кросс-β-структуры.

Поэтому

содержание

кросс-β-структуры

в

образованных

агрегатах

было

выбрано

в

качестве

параметра,

характеризующего амилоидогенность мутантных форм апомиоглобина. Для

того чтобы сравнить вторичную структуру агрегатов апомиоглобина дикого

типа и его мутантных форм были измерены инфракрасные спектры растворов

всех исследованных белков после 24 ч инкубации.

Растворы крупных агрегатов в большинстве случаев гетерогенны, из-за

этого в аликвотах одинакового объема может присутствовать различное

количество белка, что приводит к погрешностям в интенсивности поглощения

на инфракрасных спектрах. Поэтому сравнение вторичной структуры агрегатов

удобнее проводить не по интенсивности поглощения на конкретной длине

волны, а по отношению поглощения на двух длинах волн, которое не зависит от

концентрации белка. В связи с этим для каждого белка было рассчитано

отношение поглощения на спектрах агрегатов на длине волны 1620 см-1, где

поглощает кросс-β-структура, к поглощению на длине волны 1650 см-1, в

которое вносят вклад α-спирали и неупорядоченная структура. Значение

данного параметра несет информацию о содержании кросс-β-структуры в

агрегатах.

Рис. 8. Зависимость отношения А1620/1650 см-1 на инфракрасных спектрах агрегатов

апомиоглобина: а) от позиции аминокислотной замены мутантных форм; б) от доли

промежуточного и нативного состояний при температуре 40°С и рН 5,5.

12

На рисунке 8 представлена зависимость отношения А1620/1650 см-1 от позиции

аминокислотной замены и от доли нативного и промежуточного состояний

мутантных форм апомиоглобина в условиях агрегации. Полученные данные

свидетельствуют о том, что способность апомиоглобина к амилоидной

агрегации не зависит от позиции аминокислотной замены, а определяется

стабильностью нативного состояния белка. Оказалось, что зависимость

содержания кросс-β-структуры в агрегатах от стабильности апомиоглобина

имеет форму купола. Это означает, что существует оптимум дестабилизации

белка, при котором количество амилоидов в растворе после инкубации

максимально, в то время как стабильные и сильно дестабилизированные белки

характеризуются низкой амилоидогенностью.

Эти данные можно объяснить, если на одном графике отложить

результаты, полученные методами нативного электрофореза и инфракрасной

спектроскопии (Рис. 9).

Из рисунка видно, что стабильные белки образуют незначительное

количество амилоидов, так как они имеют низкую способность к агрегации. В

отличие от этого, сильно дестабилизированные белки формируют агрегаты,

которые характеризуются низким содержанием или отсутствием кросс-β-

структуры.

Рис. 9. Зависимость интенсивности окраски полосы мономерного апомиоглобина на

электрофореграмме белковых растворов после 24 ч инкубации (

) и отношения А1620/1650см-1

на ИК спектрах агрегатов (

) от доли промежуточного и нативного состояний при

температуре 40°С и рН 5,5.

Это указывает на то, что нестабильные белки, наряду с амилоидами,

образуют также неамилоидные агрегаты, то есть в одних и тех же условиях

13

растворителя наблюдаются два различных пути агрегации апомиоглобина,

соотношение

между

которыми

определяется

стабильностью

нативного

состояния белка.

Таким

образом,

результаты,

полученные

в

данной

работе,

свидетельствуют

о

том,

что

дестабилизация

нативного

состояния

апомиоглобина является необходимым условием агрегации белка, тогда как для

амилоидной агрегации необходима определенная степень дестабилизации

нативной структуры.

5. Определение участков апомиоглобина, образующих

межмолекулярные взаимодействия в структуре амилоидов

Для

экспериментального

определения

амилоидогенных

участков

апомиоглобина был использован метод ограниченного протеолиза фибрилл с

последующим анализом полученных пептидов методом масс-спектрометрии.

Метод ограниченного протеолиза основан на обработке белков либо белковых

агрегатов протеолитическими ферментами. При этом протеолизу подвергаются

участки полипептидной цепи, экспонированные на растворитель, тогда как

участки белка, образующие плотные контакты в структуре, не доступны к

действию протеаз.

Возможность протеолиза конкретного участка полипептидной цепи

зависит от его структурированности, а также от специфичности используемой

протеазы. Поэтому при исследовании структурных характеристик белковых

агрегатов методом ограниченного протеолиза мы использовали протеиназу К,

которая характеризуется низкой специфичностью. Вывод о том, что данный

участок образует межмолекулярные взаимодействия в амилоидах, можно

сделать на основании того, что он подвергается гидролизу в мономерном белке,

но устойчив к протеолизу в структуре агрегата. В связи с этим нашей задачей

был подбор условий и времени протеолиза, при которых наблюдается

максимально полный гидролиз мономерного апомиоглобина, но не происходит

полного протеолиза фибрилл.

Для определения оптимального времени реакции мы исследовали

кинетику

протеолиза

мономерного

белка

и

амилоидов.

Сравнение

молекулярных масс пептидов, присутствующих в растворе после протеолиза

мономера и агрегатов, проводили методом пептидного электрофореза в трис-

трициновой системе. Электрофореграммы растворов мономера и амилоидов

апомиоглобина V10F, отобранных через

различное время протеолиза

протеиназой К представлены на рисунке 10.

14

Рис. 10. Электрофореграммы проб, отобранных через различное время протеолиза

протеиназой К мономерного апомиоглобина V10F и амилоидов: 1 – маркер молекулярных

весов (кДа); 2 - мономерный апомиоглобин до протеолиза; 3, 4, 5 – после 30 мин, 1 ч и 2 ч

протеолиза, соответственно; 6, 7, 8 – амилоиды после 30 мин, 1 ч и 2 ч протеолиза.

Результаты пептидного электрофореза свидетельствуют о том, что

мономерный белок полностью расщепляется протеазой через 2 часа протеолиза.

В отличие от этого, при разделении образца после двух часов протеолиза

амилоидных агрегатов, в геле видны полосы пептидов. Это говорит о том, что в

составе амилоидных агрегатов присутствуют протяженные участки белка,

устойчивые к протеолизу.

Анализ пептидов, присутствующих в растворе после двух часов

протеолиза амилоидов, был проведен с использованием метода масс-

спектрометрии. Перед анализом смесь пептидов разделяли с помощью

хроматографии в обращенной фазе. Через каждые 1,2с прохождения

хроматографии снимали масс-спектры образца, выходящего с колонки. Все

зарегистрированные ионы пептидов подвергали фрагментации

методом

диссоциации,

инициированной

соударениями

с

инертным

газом.

Математическая обработка полученных масс-спектров позволила определить

молекулярные

массы

и

аминокислотные последовательности

пептидов,

присутствующих в растворе. Среди них наиболее интенсивные сигналы

наблюдались для семи пептидов, для которых в таблице 1 представлены

значения отношений массы к заряду ионов пептидов (m/z), рассчитанные

молекулярные массы, а также участки последовательности апомиоглобина,

соответствующие данным пептидам.

Из таблицы видно, что некоторые пептиды соответствуют одним и тем

же участкам цепи, но отличаются друг от друга на несколько аминокислотных

остатков. Такая гетерогенность может быть связана с низкой специфичностью

протеиназы К или с некоторым полиморфизмом в структуре амилоидов. По

полученным результатам были определены три минимальных участка

апомиоглобина, которые формируют межмолекулярные взаимодействия в

15

структуре амилоидов. Эти участки соответствуют 1-27, 60-90 и 97-127

аминокислотным остаткам и расположены в А-, Е-, F- и G-спиралях белка.

Таблица 1 - Пептиды, регистрируемые с максимальным сигналом в растворе после

протеолиза протеиназой К амилоидов мутантной формы апомиоглобина V10F

Участок

Мол.

m/z

масса

(Да)

1012,8378

3035,4963

1216,2976

3645,8765

1125,3257

3372,9609

894,0203

3572,0564

793,6246

3963,0906

694,7040

4162,1865

714,3903

3566,9150

белка

(номер

амк. ост.)

1-27

1-32

60-90

60-92

93-127

93-129

97-127

Последовательность

MVLSEGEWQLFLHVWAKVEADVAGHGQ

MVLSEGEWQLFLHVWAKVEADVAGHGQDILIR

EDLKKHGVTVLTALGAILKKKGHHEAELKPL

EDLKKHGVTVLTALGAILKKKGHHEAELKPLAQ

SHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGAD

SHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQ

KHKIPIKYLEFISEAIIHVLHSRHPGDFGAD

1

2

3

4

5

6

7

Оказалось, что эти участки хорошо согласуются с амилоидогенными

участками апомиоглобина, предсказанными с помощью ряда теоретических

алгоритмов, описанных в литературе [Fernandez-Escamilla, 2004; Garbuzynskiy

2010; Emily, 2013]. В качестве примера на рисунке 11 представлены результаты

сравнения с предсказанием с помощью алгоритма TANGO.

Рис. 11. Аминокислотная последовательность мутантной формы апомиоглобина V10F.

Заливкой выделены участки белка, устойчивые к протеолизу в структуре амилоидов,

жирным

шрифтом

отмечены

амилоидогенные

участки

апомиоглобина

согласно

теоретическому

алгоритму

TANGO

[Fernandez-Escamilla,

2004].

Прямоугольниками

показаны участки спирализации в нативном состоянии апомиоглобина.

Большинство теоретических алгоритмов, описанных в литературе,

разработаны на основании экспериментальных результатов по агрегации

коротких пептидов и белков из развернутого состояния и предсказывают

амилоидогенные участки с учетом только аминокислотной последовательности

белка. При этом в качестве амилодогенных данные алгоритмы выделяют

наиболее гидрофобные участки цепи. Результаты, полученные в данной работе,

16

свидетельствуют в пользу того, что такие алгоритмы также могут достаточно

достоверно

предсказать

амилоидогенные

участки

при

агрегации

структурированных глобулярных белков.

6. Стадии амилоидной агрегации апомиоглобина

Кинетика амилоидообразования апомиоглобина была исследована методами

флуоресценции тиофлавина Т и электронной микроскопии.

Кинетические

кривые связывания тиофлавина Т могут быть описаны двухэкспоненциальным

приближением, что говорит о том, что в процессе амилоидообразования белка

присутствуют как минимум две стадии, на каждой из которых происходит

увеличение содержания кросс-β-структуры (Рис. 12а).

Рис. 12. а) Кинетическая кривая агрегации мутантной формы апомиоглобина V10F,

регистрируемая методом тиофлавиновой флуоресценции; электронные микрофотографии

агрегатов белка после б) 48 минут и в) 24 ч инкубации при температуре 40°С.

Исходя из значений полувремени реакции, первая стадия агрегации

практически завершается через 48 мин инкубации раствора при 40°С. Данные

электронной микроскопии свидетельствуют о том, что за это время образуются

преимущественно глобулярные агрегаты (Рис. 12б). На последующих этапах

происходит образование фибриллярных структур (Рис. 12в).

Таким

образом,

экспериментально

наблюдаются

две

стадии

амилоидной

агрегации

апомиоглобина:

на

первой

стадии

образуются

глобулярные агрегаты, содержащие кросс-β-структуру, затем происходит

формирование фибрилл, которое сопровождается дальнейшим увеличением

содержания β-структуры.

17

7. Влияние аминокислотных замен в апомиоглобине на скорость

амилоидной агрегации

К настоящему времени большинство экспериментальных исследований

амилоидообразования белков было проведено в денатурирующих условиях.

Полученные результаты свидетельствуют о том, что увеличение гидрофобности

в результате аминокислотных замен в амилоидогенных участках белка ускоряет

образование фибрилл [Chiti, 2003]. Наблюдается ли такая зависимость при

агрегации структурированных глобулярных белков? Для того чтобы ответить на

этот вопрос, мы исследовали кинетику амилоидной агрегации мутантными

формами апомиоглобина в выбранных условиях методом флуоресценции

тиофлавина Т. По результатам аппроксимации полученных кинетических

кривых были рассчитаны значения скоростей первой и второй видимых стадий

агрегации белков.

Кроме этого, для каждой аминокислотной замены было рассчитано

изменение гидрофобности остатков. Значения данного параметра были взяты из

работы Fauchere J.L. and Pliska V., в которой гидрофобность соответствует

свободной энергии переноса боковой группы из воды в спирт [Fauchere, 1983].

Зависимость скорости первой видимой стадии агрегации от изменения

гидрофобности в результате мутаций представлена на рисунке 13а.

Рис. 13. Зависимость скорости первой стадии амилоидообразования: а) от изменения

гидрофобности

аминокислотных

остатков

в

результате

мутации;

б)

от

позиции

аминокислотной замены. Замены расположены в амилоидогенном участке (

) и вне

амилоидогенного участка (

). Прямоугольниками отмечены спирали нативного состояния

белка, в которых расположены аминокислотные замены.

Полученные результаты свидетельствуют о том, что гидрофобность

аминокислотных

остатков

не

влияет

на

скорость

начальных

этапов

амилоидообразования апомиоглобина. При этом из рисунка видно, что скорость

агрегации зависит от позиции аминокислотной замены: замены в позициях

18

W14, E109, L115 и M131 ускоряют амилоидную агрегацию по сравнению с

белком дикого типа, тогда как замены в позиции V10 приводят к замедлению

этого процесса (Рис. 13б). Полученные данные свидетельствуют в пользу того,

что теоретические алгоритмы предсказания влияния аминокислотных замен на

скорость амилоидообразования, которые рассматривают гидрофобность в

качестве основного параметра амилоидогенности, не всегда могут быть

применимы для предсказания агрегации структурированных глобулярных

белков.

На рисунке 14а представлена зависимость скорости второй видимой

стадии агрегации от изменения гидрофобности остатков в результате

произведенных замен. Видно, что на рисунке не наблюдается четкой

зависимости между данными параметрами.

Рис. 14. Зависимость скорости второй стадии амилоидообразования: а) от изменения

гидрофобности

аминокислотных

остатков

в

результате

мутации;

б)

от

позиции

аминокислотной замены. Замены расположены в амилоидогенном участке (

) и вне

амилоидогенного участка (

). Прямоугольниками отмечены спирали нативного состояния

белка, в которых расположены аминокислотные замены.

На рисунке 14б представлен график зависимости значений скорости

второй стадии амилоидообразования от позиции аминокислотной замены.

Оказалось, что мутантные формы, содержащие замены на фенилаланин в

позициях V10, W14 и L115, агрегируют быстрее по сравнению с белками,

содержащими замены в этих же позициях на аланин. Согласно результатам

ограниченного протеолиза три данных остатка расположены в участках

апомиоглобина,

которые

образуют

межмолекулярные

взаимодействия

в

структуре

амилоидов.

Вероятно,

гидрофобные

или

ароматические

взаимодействия, образуемые остатками в этих позициях, важны на последней

стадии амилоидной агрегации.

19

ВЫВОДЫ

1.

Апомиоглобин

дикого

типа и

его мутантные формы

при

температуре 40°С и рН 5,5 образуют амилоидные агрегаты.

2.

Существует оптимум дестабилизации апомиоглобина, при котором

амилоидная агрегация наиболее эффективна, при этом белки со слабой

степенью дестабилизации нативного состояния имеют низкую способность к

агрегации, а белки с сильно дестабилизированным нативным состоянием

образуют агрегаты c низким содержанием β-структуры.

3.

Участки, устойчивые к протеолизу в составе амилоидных агрегатов

апомиоглобина, включают участки А-, E-, F- и G-спиралей нативной структуры

белка.

4.

Аминокислотные замены в позиции V10 приводят к замедлению

первой видимой стадии амилоидной агрегации. Замены в остальных

исследованных позициях ускоряют амилоидную агрегацию. Скорость второй

видимой стадии амилоидообразования выше для мутантных форм, содержащих

замены на фенилаланин в позициях V10, W14 и L115, по сравнению с белками,

содержащими замены в этих же позициях на аланин.

СПИСОК ПУБЛИКАЦИЙ ПО ТЕМЕ ДИССЕРТАЦИИ

Статьи

1. Katina N., Timchenko A., Kihara H., Balobanov V., Vasiliev V., Kashparov I.,

Bychkova V. Kinetics of apomyoglobin association. Macromol. Symp., 2012, 317-

318 (1), 215-226.

2. Катина Н.С., Ильина Н.Б., Кашпаров И.А., Балобанов В.А., Васильев В.Д.,

Бычкова В.Е. Мутантные формы апомиоглобина с одиночными заменами в

положении Val10 способны образовывать амилоидные структуры при

пермиссивной температуре. Биохимия, 2011, 76(5), 680-691.

3. Samatova E.N., Melnik B.S., Balobanov V.A., Katina N.S., Dolgikh D.A.,

Semisotnov G.V., Finkelstein A.V., Bychkova V.E. Folding intermediate and folding

nucleus for I→N and U→I→N transitions in apomyoglobin: contribution by

conserved and nonconserved residues. Biophys. J, 2010, 98(8), 1694-1702.

4. Балобанов В.А., Ильина Н.Б., Катина Н.С., Кашпаров И.А., Долгих Д.А.,

Бычкова В.Е. Кинетика взаимодействия апомиоглобина с фосфолипидной

мембраной. Молекулярная биология, 2010, 44(4), 708-717.

5. Samatova E.N., Katina N.S., Balobanov V.A., Melnik B.S., Dolgikh D.A.,

Bychkova V.E., Finkelstein A.V. How strong are side chain interactions in the

folding intermediate? Protein.Sci., 2009, 18(10), 2152-2159.

20

6. Барышникова (Саматова) Е.Н., Мельник Б.С., Балобанов В.А., Катина Н.С.,

Финкельштейн A.В., Семисотнов Г.В., Бычкова В.Е. О роли некоторых

консервативных и неконсервативных аминокислотных остатков в переходном

состоянии и в интермедиате сворачивания апомиоглобина. Молекулярная

биология, 2008, 43(1), 136-147.

7. Барышникова Е.Н., Балобанов В.А., Катина Н.С., Мельник Б.С., Долгих Д.А.,

Семисотнов Г.В., Бычкова В.Е. Равновесное разворачивание мутантных форм

апомиоглобина с заменами консервативных нефункциональных остатков на

аланин. Молекулярная биология, 2007, 41(4), 674-680.

Тезисы докладов и стендовых сообщений

1. Катина Н.С., Григорашвили Е.И., Никулин А.Д., Рябова Н.А., Суворина

М.Ю., Сурин А.К. Определение участков полипептидной цепи апомиоглобина,

отвечающих за формирование остова амилоидных фибрилл. Седьмой съезд

ВМСО, 6 Всероссийская конференция с международным участием «Масс-

спектрометрия и ее прикладные проблемы», Россия, Москва, 2015, с.65.

2. Katina N.S., Grigorashvili E.I., Suvorina M.Y., Nikulin A.D., Surin A.K.

Identification of apomyoglobin regions responsible for amyloid formation. 33rd

FEBS Congress, Germany, Berlin, 2015.

3. Катина Н.С., Балобанов В.А., Пермяков С.А., Вазина А.А., Никулин А.Д.,

Васильев В.Д., Кашпаров И.А., Ильина Н.Б., Бычкова В.Е. Влияние

стабильности

мутантных

форм

апомиоглобина

на

их

способность

к

образованию амилоидов. Международная конференция по биоорганической

химии, биотехнологии и бионанотехнологии, Россия, Москва, 2014, с.30.

4. Галзитская О.В., Катина Н.С., Довидченко Н.В., Балобанов В.А., Ильина

Н.Б.,

Котова

Н.В.,

Гарбузинский

С.А.,

Сурин

А.К.,

Бычкова

В.Е.

Экспериментально-теоретическое

изучение

механизма

неправильного

сворачивания белков и связь этого процесса с болезнями, связанными с

амилоидообразованием. Фундаментальные науки – медицине, Россия, Москва,

2009, с.178-179.

5. Катина Н.С., Дудина М.А., Балобанов В.А., Ильина Н.Б., Кашпаров И.А.,

Бычкова В.Е. Влияние стабильности белковой структуры на процесс

образования

амилоидов

мутантными

формами

апомиоглобина.

13-я

международная Пущинская школа-конференция молодых ученых, Россия,

Пущино, 2009, с.21.

6. Дудина М.А., Катина Н.С., Балобанов В.А., Ильина Н.Б., Кашпаров И.А.,

Васильев В.Д., Бычкова В.Е. Образование амилоидоподобных структур

мутантами апомиоглобина с заменами в положении Val-10 и их стабильность.

21

XXI зимняя молодежная научная школа «Перспективные направления физико-

химической биологии и биотехнологии», Россия, Москва, 2009, с.32.

7. Katina N.S., Dudina M.A., Balobanov V.A., Melnik B.S., Vasiliev V.D.,

Bychkova V.E. Mutant forms of apomyoglobin can form amyloid-like structures at

permissive temperature. International Bunsen discussion meeting on structure of

amyloid fibrils and mechanism of amyloid formation, Germany, Halle, 2009, p.66.

8. Katina N.S., Dudina M.A., Balobanov V.A., Samatova E.N., Bychkova V.E.

Possible mechanism of amyloid formation by apomyoglobin mutants. 2009,

Biophys.J., I.3, Supl.1, p.218a.

9. Katina N.S., Balobanov V.A., Samatova E.N., Galzitskaya O.V., Garbuzinskiy

S.O., Bychkova V.E. Studying the mechanism of amyloid formation by

apomyoglobin mutant forms. 33rd FEBS Congress & 11th IUBMB Conference,

Greece, Athens, 2008, p.191.

10. Balobanov V.A., Katina N.S., Samatova E.N., Bychkova V.E. Intermediates,

which are observed during denaturation by different agents, are one and the

thermodynamic state. Abstracts. 33rd FEBS Congress & 11th IUBMB Conference,

Greece, Athens, 2008, p.215.

11. Балобанов В.А., Катина Н.С., Саматова (Барышникова) Е.Н., Ильина Н.Б.,

Кашпаров И.А., Бычкова В.Е. Применение метода фазовых диаграмм для

описания

нативного,

промежуточного

и

развернутого

состояний

апомиоглобина. III Российский симпозиум Белки и пептиды”, Россия, Пущино,

2007, с.35.

12. Катина Н.С., Балобанов В.А., Барышникова Е.Н., Ильина Н.Б., Кашпаров

И.А., Финкельштейн А.В.,. Бычкова В.Е. Роль боковых групп аминокислотных

остатков

в

структуре

промежуточного

состояния

апомиоглобина.

III

Российский симпозиум “Белки и пептиды”, Россия, Пущино, 2007, стр. 32.

13. Katina N.S., Balobanov V.A., Samatova E.N., Melnik B.S., Semisotnov G.V.,

Bychkova V.E., Finkelstein A.V. Heterogenity of the molten globule state of

apomyoglobin. International conference on “Protein biosynthesis, structure and

function”, Russia, Puchshino, 2007, p.81.

14. Balobanov V.A., Katina N.S., Ilyina N.B., Kashparov I.A., Baryshnikova-

Samatova E.N., Bychkova V.E. Phase diagrams of apomyoglobin in coordinates of

pH, temperature and urea concentration. International conference on “Protein

biosynthesis, structure and function”, Russia, Puchshino, 2007, p.57.

15. Katina N.S., Balobanov V.A., Ilyina N.B., Kashparov I.A., Samatova E.N.,

Bychkova V.E. pH-induced denaturation of mutant forms of apomyoglobin.

International conference on “Protein biosynthesis, structure and function”, Russia,

Puchshino, 2007, p.82.

22

16. Катина Н.С., Балобанов В.А., Барышникова Е.Н., Бычкова В.Е. Влияние

замены гидрофобных аминокислотных остатков на стабильность нативного и

промежуточного состояний апомиоглобина. Конференция “Современные

проблемы молекулярной биофизики”, Россия, Санкт-Петербург, 2006, с.18.

17. Балобанов В.А., Катина Н.С., Мельник Б.С., Барышникова Е.Н., Бычкова

В.Е.. Влияние рН и температуры на скорость сворачивания и разворачивания

апомиоглобина.

Конференция

“Современные

проблемы

молекулярной

биофизики”, Россия, Санкт-Петербург, 2006, с.17.

18. Балобанов В.А., Катина Н.С., Барышникова Е.Н., Ильина Н.Б., Кашпаров

И.А., Бычкова В.Е. Исследование влияния точечных мутаций в А-спирали

апомиоглобина кашалота на стабильность его нативного и промежуточного

состояний.

18-я

зимняя

молодежная

научная

школа

“Перспективные

направления физико-химической биологии и биотехнологии”, Россия, Москва,

2006, с.30.

19. Катина Н.С., Балобанов В.А., Барышникова Е.Н., Ильина Н.Б., Кашпаров

И.А., Бычкова В.Е. Исследование влияния аминокислотных замен в Н-спирали

апомиоглобина кашалота на стабильность его нативного и промежуточного

состояний.

18-я

зимняя

молодежная

научная

школа

“Перспективные

направления физико-химической биологии и биотехнологии”, Россия, Москва,

2006, с.39.

23



Похожие работы:

«Антипов Владислав Анатольевич ПРИНЦИПЫ ПОСТРОЕНИЯ И ПОПУЛЯЦИОННО-ГЕОГРАФИЧЕСКАЯ ИЗМЕНЧИВОСТЬ ПЕСНИ ВОСТОЧНОГО СОЛОВЬЯ (Luscinia luscinia L., 1758) 03.02.04 зоология АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата биологических наук Москва 2015 2 Работа выполнена на кафедре зоологии позвоночных биологического факультета Московского государственного университета имени М.В.Ломоносова. Научный руководитель: доктор биологических наук, Иваницкий Владимир Викторович...»

«ЗЕМЛЕМЕРОВА ЕЛЕНА ДМИТРИЕВНА МОЛЕКУЛЯРНАЯ ФИЛОГЕНИЯ И ФИЛОГЕОГРАФИЯ КРОТОВ ТРИБЫ TALPINI (MAMMALIA: TALPIDAE) 03.02.04 – зоология АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата биологических наук Москва – 2015 Работа выполнена на кафедре зоологии позвоночных биологического факультета Московского государственного университета имени М.В.Ломоносова Научный руководитель: кандидат биологических наук Банникова Анна Андреевна Официальные оппоненты: доктор...»

«НИКУЛИНА Ольга Юрьевна БАБЕЗИОЗ СОБАК В РЯЗАНСКОЙ ОБЛАСТИ (РАСПРОСТРАНЕНИЕ, ОСОБЕННОСТИ ЭПИЗООТОЛОГИИ, ЛЕЧЕНИЕ) Специальность: 03.02.11 – паразитология АВТОРЕФЕРАТ диссертации на соискание ученой степени кандидата ветеринарных наук Москва 2016 Ведущая организация: аграрный университет. ФГБОУ ВО Ставропольский государственный Защита диссертации состоится 10 февраля 2016 г. в 14:30 ч на заседании совета по защите диссертаций на соискание ученой степени кандидата наук, на...»





 
© 2015 www.z-pdf.ru - «Бесплатная электронная библиотека»

Материалы этого сайта размещены для ознакомления, все права принадлежат их авторам.
Если Вы не согласны с тем, что Ваш материал размещён на этом сайте, пожалуйста, напишите нам, мы в течении 1-2 рабочих дней удалим его.